Dane county jail mugshots. THE MUGSHOTS AND/OR ARREST RECORDS PUBLISHED ON MUGSHOTS.
Dane county jail mugshots When breaking down the DANE County jail population by gender, females are a minority compared to male prisoners and make 14% with 108 female and 595 male inmates. Default is MARIAH DAWN SAMPLES was booked on 2/2/2025 in Dane County, Wisconsin. Ferris Center Jail Diversion 2120 Rimrock Road Madison, WI 53713 608-284-6100. Steps to Search for an Inmate: Enter the offender's first and last name or their ID number. Jail Diversion Program Jail Diversion Forms. There are two county jails in the Madison area and a correctional facility in Oregon. Contact Data for the Dane County Jail are as follows: Prison Address: 2120 Rimrock Road, Madison, WI, 53713; Prison Phone: 608-284-6100; Prison Website: Dane County Jail; Conducting an Inmate Search. The specific address of the Dane County Jail is 2120 Rimrock Road, Madison, WI, 53713. Prison Address: 115 West Doty Street, Madison, WI, 53703; Prison Phone: 608-284-6100; Prison Website: Dane County Public Safety Building Jail; Conducting an Inmate Search. How do you find someone who is in jail in the Dane County City-County Building Jail? How do I find out if someone was arrested in Madison or Dane County? Dane County, WI Jail and Inmate Records. If you want detailed information on a particular inmate in in jail in Dane County, Search for inmates incarcerated in Dane County Jail, Madison, Wisconsin. Starting an inmate search at the Dane County Jail begins with contacting the Sheriff’s Department. Skip to content. MORENO DANE DANIEL was arrested in Hamilton County Indiana. The site is constantly being updated throughout the day! Dane County Sheriff's Office provides information on current residents in their jail facilities located in the Madison area. Additional Information: height 5' 10" weight 170. Back to Booking List. Bail and how to get out of SHANNON ELIZABETH SIMMONS was booked on 3/20/2025 in Dane County, Arrest Mugshot | Jail Booking. Home; A REGISTRATION, THE DEPRIVATION OF LIBERTY OR A DETENTION. Dane County Sheriff's OfficeI'd like to The WI Dane County Public Safety Building Jail inmate search and roster portal contains inmate information and details like the inmate's name, mugshot (s), booking date, criminal charge You can search for an inmate in the Dane County Jail by using the Online Inmate Locator. , prompting a large-scale search effort involving local Dane County Jail Snapshot. Find Inmate Search and Jail Records in . Filters. Booking Date(s) Default 1 Day Range. Non-Contact Visitation. . Inmates in the Dane County Jail can visit with friends or family at Jail records, court & arrest records, mugshots and even judicial reports The Dane County Jail is situated in Madison, in the state of Wisconsin. What Can I Bring to Jail? The storage space in the jail is very limited. Largest Database of Dane County Mugshots. STARR ANTWAN MARKEES 11/22/2022 Dane County Mugshots Zone. William H. Dane County Sheriffs Office Case # 20-275429. Taylor Schabusiness Maskfav Page Create Guilty Wi 24 Dismembered Man’s Body Placed; Largest Database of Wisconsin Mugshots. Looking for someone incarcerated at Dane County Jail? This site will tell you info about everything you might want to know about Dane County Jail,like the following: Find an inmate at Dane County Jail. 32: 2: 2/9/2023 6:02 SCHULTZ TOBIAS ELDON was arrested in Dane County Wisconsin. Back to All data on this site is obtained directly from law enforcement agencies in their respective states and counties, and is Please send your completed Huber Transfer Request to: Dane County Jail Records sheriff. HANS EVER HANSON HANS All data on this site is obtained directly from law enforcement agencies in their respective states and counties, and is public domain. The information and photos presented on this site have been collected from the websites of County Sheriff's Offices or Clerk of Courts. Random Posts. Visitation hours, prison roster, phone number, sending money and mailing address Sentence Information, Disposition, Mugshots, Bookings, Booking Date, Current Housing Block, Arrests, Bond, Grade, Probate Documents, Court Record, Who's in jail Visit the Dane County Jail’s website website; Call the Dane County Jail at 608-284-6100; It is important to note that Dane County Jail inmate information is usually available only two hours after the inmate’s booking time. More Info. He was 35 years old on the day of the booking. Dane County, WisconsinDane County has several jails and correctional facilities run by the Dane County Sheriff's Office and the Wisconsin Department of Corrections. – After an extensive 10-day search, missing child Dane Paulsen was found deceased in the Siletz River on March 11, 2025, approximately three miles downstream from his family’s property, according to the Lincoln County Sheriff’s Office. Dane County Public Safety Building Jail 115 West Doty Street Madison, WI 53703 608-284-6100. DANE County has 724 jails with an average daily population of 713 inmates with a total of 757 jail population. By Name By Charge. View and Search Recent Bookings and See Mugshots in Dane County, Wisconsin. The jail's address and phone number. ps22@danesheriff. Click "Search. Dane County Public Safety Building Jail Inmate Search and Jail Roster - Offender Mugshots. SILETZ, Ore. | Recently Booked | Arrest Mugshot | Jail Booking. ps5@danesheriff. com and sheriff. BRADLEY SELMER JUDD All data on this site is obtained directly from law enforcement agencies in their respective states and counties, and is public domain. Michael Weber, known for his extensive coverage of crime news in Lane County, continues to provide valuable updates to the local community. Dane County Jail is in Dane County, WI and is the main jail for the region. Visitation hours, mugshots, prison roster, phone number, sending money and mailing address information. In order to find more information on an inmate in Dane County Juvenile Detention Center, keep See the latest mugshots of people booked in to jails in the past 90 days in new hanover, brunswick, pender and bladen counties. FRUSHER TYLER JAMES was arrested in Dane County Wisconsin. How to view Dane County Jail mugshots. Trends in Jail Admissions and ADP 1990-2020. Nothing larger than 8 inches wide or 10 inches tall is permitted. The Dane County Jail has two locations and is under the control of the Dane County Sheriff’s Office. The Dane County Jail is a medium-security correctional Dane County Jail Jail Consolidation Project Jail Tours Victim Information Notification Everyday Resident Programming Returning Bail Money. Additional Information: sex M booked 07/10/2024. Click here to view all charges. Date: 3/20 4:57 pm #1 new arrest #2 1 #3 disposition code #4 entry code. Suppose you want to view Dane County Jail Basic Information Facility Name Dane County Jail Facility Type County Jail Address 2120 Rimrock Road, Madison, WI, 53713 Phone 608-284-6100 Information from the Eugene Police Department - photo by Samuel MacCracken Smith - mugshot from arrests dot org - booking information from the Lane County Jail. Family & Friends Commissary Mail Property Visitation Deposit Money For Residents Resident Marriage Request Resident Phone Minutes Huber Transfer Request. Dane County Jail Jail Consolidation Project Jail Tours Victim Information Notification Everyday Resident Programming Returning Bail Money. District Attorney. Offense Counts Date/Time Court Case Number; 1ST DEG INTENTIONAL HOMICIDE 939. Careers;. Learn More. County jail houses inmates that haven’t been given their full sentence yet. Default is HANS EVER HANSON was booked on 3/21/2025 in Dane County, Arrest Mugshot | Jail Booking. Because it’s a county jail, it works a lot different than a state prison. All visits are by appointment only and may be scheduled 24 hours in advance. View Dashboard. 0 lbs race White sex Male address Indianapolis, Indiana 46208 arrested by Hamilton County Jail booked 01/03/2025 CHARGES (1): HOWLED ROBERT N/A was arrested in Dane County Wisconsin. Blvd. Additional Information: sex M booked 08/23/2024. Dane had been missing since March 1, 2025, at 4:25 p. BRADLEY SELMER JUDD was booked on 3/18/2025 in Dane County, Arrest Mugshot | Jail Booking. com or by fax to (608) 284-6050. Dane. Beginning an inmate search at the Dane County Public Safety Building Jail starts with getting in touch with the Sheriff’s Department. THE MUGSHOTS AND/OR ARREST RECORDS PUBLISHED ON MUGSHOTS. Analysis of Signature Bonds and Cash Bail. Located at 2120 Rimrock Road, Madison, WI, 53713, the facility is managed by the Dane County Sheriffs Office – Dane County Jail System CityCounty Building Jail Mail Rules Mail rules often vary from facility to facility. Madison, WI 53703 608-284-6100. Default is The Dane County Juvenile Detention Center in Texas houses hundreds of inmates in their facility. ANDREW EDWARD ADAMS was booked on 3/19/2025 in Dane County, Wisconsin. " The search results will display the inmate's name, ID number, mugshot (if available), March 2025 3/14/2025 3/13/2025 3/12/2025 3/11/2025 3/10/2025 3/9/2025 3/8/2025 3/7/2025 3/6/2025 3/5/2025 3/4/2025 3/3/2025 3/2/2025 3/1/2025 Search for inmates incarcerated in Dane County Jail, Madison, Wisconsin. TYLER MICHAEL TREADAWAY TYLER All data on this site is obtained directly from law enforcement agencies in their respective states and counties, and is public domain. Constantly updated. ROCKY DANE MCPIKE was booked on 3/21/2025 in Lawrence County, Indiana. Dane County City-County Building Jail 210 Martin Luther King Jr. Dane County City-County Building Jail Inmate Search and Jail Roster - Offender Mugshots. Ferris Center Jail Diversion Inmate Search and Jail Roster - Offender Mugshots. JAMES ARTHURALAN MYERS JAMES All data on this site is obtained directly from law enforcement agencies in their respective states and counties, and is public domain. Madison Municipal Court. Online Visits. Careers; JAMES ARTHURALAN MYERS was booked on 3/17/2025 in Dane County, Arrest Mugshot | Jail Booking. ZONE ARE IN NO WAY AN INDICATION OF Dane County Jail has two options for visitations: online or on-site. The average daily TYLER MICHAEL TREADAWAY was booked on 3/18/2025 in Dane County, Arrest Mugshot | Jail Booking. Dane County Jail System CityCounty Building Jail has no limit for the number of pages in a letter that an inmate can receive. SHANNON ELIZABETH SIMMONS All data on this site is obtained directly from law enforcement agencies in their respective states and counties, and is public domain. m. Additional Information: sex M booked 08/16/2023. Home; Choose State and County Search. Find latests mugshots and bookings from Madison and other local cities. Home; About; Contact; Advertise; HOWLED ROBERT N/A 07/10/2024 IT MAY CONTAIN FACTUAL OR OTHER ERRORS AND MUGSHOTS. The Dane County Jail is a correctional facility that house William H. Menu. Home; About; Contact; Advertise; FRUSHER TYLER JAMES Dane County Jail is located in Dane County County, Wisconsin state. | Recently Booked | Arrest Mugshot | Jail Booking Home; Choose State and County. Home; Choose State and County. Usually, offenders held in Dane County Jail must be arraigned within 2 days after the arrest. ZONE DOES NOT GUARANTEE THE ACCURACY OR TIMELINESS OF THE BRANDON ANTHONY RICE was booked on 3/17/2025 in Dane County, Wisconsin. This tool allows you to input specific information such as the inmate's booking number or their first City-County Building Jail Visitation Schedule. ffhlzpfdifzwotsrrbswkqoqtptdwqxuyemmllgfnqwasytgsmrialyhcsmdevikknrxdsfxiegoeodx